IGF-1 LR3 1mg

IGF1 LR3 allows for many of the growth-promoting effects of growth hormone insulin-like growth factors also know as IGF's.
IGF-1 LR3 comprises a family of peptides (protiens) that play important roles in mammalian growth and development.
IGF1 LR3 is also known as Long R3 IGF-1 or Insulin-Like Growth Factor-I Long Arg3.
The Long R3 IGF-1 version is significantly more potent than regular IGF-1.
The enhanced potency is due to the decreased binding of IGF1 LR3 to all known IGF binding proteins.
These binding proteins normally inhibit the biological actions of IGF's therefore IG-1 LR3 has been shown to have increased efficacy and function .

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da