IGF1 DES 1mg

Insulin Like Growth Factor (IGF)-1 (4-70), otherwise known as IGF-1 DES, produced in E. coli, is a single, non-glycosylated,
polypeptide chain containing 67 amino acids and having a molecular mass of 7,372 Da.
In vitro studies demonstrate that at equal doses DES (1-3) IGF is ten times more potent than IGF-1 at stimulating hypertrophy and proliferation in cultured cells.
It is likely generated through post-translational modification in the sequence of circulating mature IGF-1 via protease action.
Insulin-Like Growth Factor-1 DES (1-3)

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 7,372 Da